PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn144711
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 449aa    MW: 49167.9 Da    PI: 8.1302
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn144711genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-39123183262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++k+l+cprC+st+tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  Achn144711 123 PDKILPCPRCNSTDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTIRNVPVGSGRRKNKSSS 183
                 7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-29120180IPR003851Zinc finger, Dof-type
PfamPF027013.2E-32125181IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.947127181IPR003851Zinc finger, Dof-type
PROSITE patternPS013610129165IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MKDPAIKLFG KTIPLLPKHH LSNLTTATTT RVAVDHEQQL SSTCSSPAEK NCNRVGDSQE  60
NGKKPSESEL TETRPEDELK DPKTPCGNPE TPSVEKEPSS PEPSKNEEQS ETSASEEKTM  120
KKPDKILPCP RCNSTDTKFC YYNNYNVNQP RHFCKNCQRY WTAGGTIRNV PVGSGRRKNK  180
SSSALHYRQI VASECLEAAR GNSINGIYRP ANGTVLSFAS DPSICESMAS AWSLAEKKKI  240
SVSCGGKKNE DDHKSRFSVS DSPGNEGYCS LQESVMANFQ TLPPQVPCFP GPPWPFPMVP  300
PAFSPSGFPI TFYPTPAYWG CTPPGSWGCT LPNPAVFPIP RSPTLGKHSR DGNIHKPSKS  360
DSEEPCKENN SERGVWVPKT LRIDDPARSS IWSTLGINNE KNDFINGGSL FKAFQSKGDE  420
KKHVEETSLA LQANPAALAR SSNFQERA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895107.11e-161PREDICTED: cyclic dof factor 1
TrEMBLF6H5U51e-160F6H5U5_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g00980.t011e-160(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-82cycling DOF factor 2